What's Lurking In Your carpet?
Mighty Kleen Carpet Services
Houston,Tx 77068
832-573-4933
Mighty Kleen Carpet Services
Houston, Tx 77068
HOMECARPETUPHOLSTERYTILE & GROUTQUOTES/ESTIMATESPET STAINS/RED STAINSSPECIALSREVIEWSREFERRALSFAQ'S/GLOSSARY

HOMECARPETUPHOLSTERYTILE & GROUTQUOTES/ESTIMATESPET STAINS/RED STAINSSPECIALSREVIEWSREFERRALSFAQ'S/GLOSSARY

Call Today 832-573-4933
Call Today 832-573-4933

What's Lurking In Your carpet?

Is Your Carpet Cleaner Making Your Carpets Dirtier?

by Charleston Gray Mighty Kleen Carpet Services on 10/19/11


Heavily soiled carpet There are so many carpet cleanersin Houston making their clients carpets get dirtier faster than usual. If you go to Google maps and type in carpet cleaning Houston you will find over six hundred cleaning companies, many which claim to be professional carpet cleaners. More than half of these companiesdo not use properly trained technicians. Some of them do not use truckmounted machines, they use portable extractors that they purchaes from pawn shops or on E-bay. These machines are usually four to six years old. Most likely they have lost a lot of vacuum power and they leave lots of dirty water and soapy residue in your carpets. With this dirty water and soapy residue deep in your carpets stains and spots may start to reappear and ther will be a constant stickines to it. This will make your carpet a dirt magnet, grabbing every ounce of dirt passing over it. Your carpet will become dirty faster, and may become dirtier than before it was cleaned.

I know you must be asking yourself, what can I do to get my carpet cleaned properly and avoid these problems? The good news is, there is a solution. The solution is to use a company like Mighty Kleen Carpet Services. There is a difference between what we do and what and what those so called professionals do. You can't get results like what we can provide using a portable cleaning machine. We are a professional carpet cleaning company that only uses truckmounted carpet machines. How do we do this? First we start by training our technicians how to use our high powered truckmounted machine.

Second, we understand the chemistry of carpet cleaning. We can remove the dirt, dust, and grime from your carpet without leaving sopay residue behind to make our carpet resoil faster. There is chemistry to the solution of rapid resoiling. Many carpet cleaners are totally unaware of this fact. They use the cheapest detergents they can find.They buy them from places Home Depot, Lowe's or Wal-mart. A professional cleaning company like Mighty Kleen would not buy their cleaning solutions from a department store. We buy top quality cleaning solutions from suppliers that carry brands like Prochem, Chemspec, Kleeenrite, and CTI.

A cleaning agents strength and characteristics are determined by it's pH. The ph of a cleaning agent is the key to proper carpet cleaning. A ph above 10 is considered alkaline, a ph about 7 is considered neutral, and ph below 6 is considered acidic. Why is this important? Because you have alkaline stains and you have acidic stains. Each opposite offsets the other, and different types of carpet require differnet levels of ph. For instance, stain protected carpets require a basically neutral cleaning agent. Use a ph level to high and you can strip the stain protection from the fibers, leaving the client with regular unprotected carpet. At Mighty Kleen we know the difference of these carpet types and will use the appropriate cleaning angent for that particular carpet. Just like cleaning your hair you must first clean with a higher ph solution that will attract the acidic dirt out, then you rinse with a lower ph solution to bring the carpet ph closer to neutral. If you do not blance the carpet ph it will continue to bring up dirt, dust and grime from the padding. This process is called "wicking", and usually occurs during the first 12 hours after cleaning, but can occur up to a week later.This is why you must use a company like Mighty Kleen.

Another cause for reappearing spots is overwetting or long drying times. This will happen when you use portable cleaning machines. Most of them can only produce about 100 to 150 cfm of vacuum. A powerful truckmount like the ones we use produce 300 to 400 cfm of vacuum. This will allow your carpet to dry within the industyr standard of 2 to 4 hours. If you need your carpet dry sooner we can provide a quick dry method for a small additional fee. So, as you can see. The only way to get your carpets cleaned and prevent quick resoiling and or reappearing spots, is to use a company that is trained in the chemistry of carpet cleaning and only uses powerful truckmounted cleaning machines.

So call 832-573-4933, email mightykleen@yahoo.com , or visit us at www.mightykleencarpetsvcs.com . We will answer all your questions concerning your carpet.
Thank you, Charleston L. Gray Jr., owner Mighty Kleen Carpet Services

It's Not Clean!
           Unless It's 
                  Mighty Kleen!
             SERVICES

  • Red Stain Removal
  • Gum 
  • Grease
  • Rust  
  • Water Stains
  • Area Rugs
  • Oriental Rugs
  • Repairs
  • Carpet Stretching
  • Office Cleaning
Tell a friend about this page
Mighty Kleen Carpet Services
Houston, Tx 77068
Office Hours: 
Monday - Friday:  8:00AM - 6:00PM    Saturday:
8:00AM -3:00PM    
Sunday:  
Closed
Appointments from:  9:00AM - 6:00PM
Telephone:
832-573-4933
Email:
mightykleen@yahoo.com
Click Here To See Our BBB                Rating
Contact Us
*
100% Money Back Guarantee!  
Visa,Mastercard, Discover, 
Amex, Debit, Checks, Cash
* When scheduling your carpet cleaning appointment please choose your day and time at least 3 days in advance. If you need an earlier appointment please call. Choose 1 or 2 alternate times in case the time slot you request is unavailable. Leave alternate appointment information in comment box.
                          Mighty Kleen Carpet Services in your Area:     

Houston,Tx77005,77007,77008,77014,77015,77018,77019,77024,77025,77027,77035,77038,77040,77041.77042,77043,77044,
77049,77055,77056,77057,77060,77064,77065,77066,77067,77068,77069,77070,77073,77079,77080,77084,77086,77088,77090,
77091,77092,77095,77096  
Humble,TX 77396,77338,77346  Kingwood,TX 77339,77345  Katy,TX 77449,77450  Friendswood,TX 77546 
Spring,TX 77373,77388 77379,77380,77386  Cypress,TX 77429,77433  Pearland,TX 77581,77584
The Woodlands,TX 77381,77382  South Houston,TX 77587  Clear Lake,TX 77062  Pasadena,TX 77502,77503 
Bellaire,TX 77501  Tomball,TX 77375,77377