Mighty Kleen Carpet Services
Houston,Tx  77068
832-573-4933
This situation is where the pet urinated on the carpet only once in each location.Urine will not have permeated heavily into carpet pad and sub floor structure.

Step 1. Each contaminated spot is liberally saturated with        designated deodorizing agent.
Step 2. Deodorizing agent is allowed to dwell at least 30 minutes.
Step 3. Lightly hot water extract treated areas leaving sufficient active product in the carpet complete the odor removal process.
Step 4. If any yellowing remains liberally apply Urine Stain Remover and allow to dry. Stain will gradually disappear as solution dries.

Light to Moderate Contamination
Heavy Contamination
 This is where the pet has repeatedly used the same spot. The carpet backing, pad and floor have been saturated by urine.
The new generation chemistry of oxidizers permanently removes pet odor contamination with the added benefit of: no 
lingering fragrances, guaranteed results, one call treatment and complete stain removal. Non allergenic and it works in about 30 minutes. Note: This procedure should not be used on natural fibers such as wool or silk.

Where the carpet can be pulled back.
Where the carpet cannot be pulled back
The preferred method of treatments to lift the carpet
as has just been explained. However, when you encounter contamination where it is impractical to lift the carpet you can treat it from the top.
 Following is the treatment sequence to use in these situations.

Step 1. Mix oxidizer solution.
Step 2. Saturate the area with oxidizing solution.
Step 3. Agitate solution with wand or carpet rake   assure total penetration.
Step 4. Allow 30 minutes dwell time.
Step 5.Using subsurface extraction tool to extract  the solution and oxidized contamination from the carpet and padding.
Step 6. Allow carpet to dry completely before covering with furniture.
Step 1.Disengage and remove carpet from contaminated area
Step 2. Remove contaminated carpet cushion.
Step 3. Sweep sub -floor to remove loose dirt.
Step 4. Liberally apply "Odor Barrier" to sub-floor, tackless             strip,gully area. (Area between tackless strip and wall.)    
Step 5. Place 1 to 2 mil. plastic sheeting over area so that it adheres to floor  surfaces.
Step 6. Tuck plastic inn around tackless and along gully so that extends 6 inches over both good carpet and up wall surfaces.
Step 7. Lay carpet back into position over plastic sheeting.
Step 8. Prepare oxidizing solution using very hot water.
Step 9. Pour hot solution onto contaminated area of carpet to totally saturate  all carpet fibers.
Step 10. Agitate solution using carpet wand or rake to move solution around   carpet.
Step 11. Apply at ratio of 1 gallon of solution per 4 or 5 square feet of carpet.
Step 12. Allow 30 minutes dwell time.
Step 13. Dry-vac carpet to remove moisture leaving carpet as dry as possible.
Step 14. Leave plastic sheeting in place and install new padding.
Step 15. Reinstall carpet.
Step 16.Trim plastic protruding along the wall at baseboard.
Step 17. Dry carpet with air movers before covering with furniture.

Carpet Ceaning Pet Stains & Odor Removal-Houston
HOMECARPETUPHOLSTERYTILE & GROUTQUOTES/ESTIMATESPET STAINS/RED STAINSSPECIALSREVIEWSREFERRALSFAQ'S/GLOSSARY

HOMECARPETUPHOLSTERYTILE & GROUTQUOTES/ESTIMATESPET STAINS/RED STAINSSPECIALSREVIEWSREFERRALSFAQ'S/GLOSSARY

Call Today 832-573-4933
Call us Today:832-573-4933
Carpet Cleaning-Red Stain Removal Houston, Tx
Watch Video
Red wine stains on clothing can be tricky to get out, but red wine stains on carpet are much worse to deal with, but Mighty Kleen has the perfect formula for complete red stain removal. If you have red stains from koolaid, soda, or red wine call Mighty Kleen today at 832-573-4933 to restore your carpet to it's original color.
Watch Video
Office Hours: 
Monday - Friday:  8:00AM - 6:00PM    Saturday:
8:00AM -3:00PM    
Sunday:  
Closed
Appointments from:  9:00AM - 6:00PM
Telephone:
832-573-4933
Email:
mightykleen@yahoo.com
Click Here To See Our BBB                Rating
Contact Us
Office Hours: 
Monday - Friday:  8:00AM - 6:00PM    Saturday:
8:00AM -3:00PM    
Sunday:  
Closed
Appointments from:  9:00AM - 6:00PM
Telephone:
832-573-4933
Email:
mightykleen@yahoo.com
Click Here To See Our BBB                Rating
Contact Us
It's Not Clean!
           Unless It's 
                  Mighty Kleen!
                            Mighty Kleen Carpet Cleaning Service In Your Area:

Houston,TX 77090   Humble,TX 77396,77338  Kingwood,TX 77339,77345  Katy,TX 77449,77450  Friendswood,TX 77546  
Spring,Tx 77373,77388 77379,77380  Cypress,TX 77429,77433  Pearland,Texas 77581 Atascocita,TX 77346  
The Woodlands,Texas 77381,77382  South Houston,TX 77587  Clear Lake,TX 77062  Pasadena,TX 77502,77503 
Bellaire,TX 77501  Tomball,TX 77375,77377

Tell a friend about this page
100% Money Back Guarantee!  
100% Money Back 
      Guarantee!  
Visa,Mastercard, Discover, 
Amex, Debit, Checks, Cash